PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A00451.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 258aa    MW: 28895.8 Da    PI: 6.7144
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A00451.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.95.4e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtfskRr g+lKKA+EL vLCda+v v+ifsstgk++ey+s
  Pahal.A00451.1  9 KRIENSTNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCS 59
                    79***********************************************96 PP

2K-box74.72.5e-25711711100
           K-box   1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                     yq++++++  e ++ ++   e++++k+e+++L++ +R++ G+dL+sL+l ++  LeqqLe s++k+R++K++ll +q+++l++ke+ l+++n+ L
  Pahal.A00451.1  71 YQHATNTHfEEINQDQQIFVEMTRMKNEMDKLETGIRRYTGDDLSSLTLDDISDLEQQLEYSVSKVRARKHQLLNQQLDNLRRKEHILEDQNTFL 165
                     56666666667788899999*************************************************************************** PP

           K-box  95 rkklee 100
                      ++++e
  Pahal.A00451.1 166 YRMINE 171
                     999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.226161IPR002100Transcription factor, MADS-box
CDDcd002651.29E-43278No hitNo description
SuperFamilySSF554551.7E-32286IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2481169IPR002487Transcription factor, K-box
PROSITE profilePS5129714.77385175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRGGLLK KANELAVLCD ARVGVVIFSS TGKMFEYCSP  60
ACSLKELIEQ YQHATNTHFE EINQDQQIFV EMTRMKNEMD KLETGIRRYT GDDLSSLTLD  120
DISDLEQQLE YSVSKVRARK HQLLNQQLDN LRRKEHILED QNTFLYRMIN ENQQAAALQG  180
GEVKLGEMAP LAMLPPPAFA PPHSGCYYGG ESSSTALQLT PAAPQLHPDV GFRLQPTQPN  240
LQDPACGGLH GHGLQLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-18185183Myocyte-specific enhancer factor 2B
1tqe_Q7e-18185183Myocyte-specific enhancer factor 2B
1tqe_R7e-18185183Myocyte-specific enhancer factor 2B
1tqe_S7e-18185183Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2712080.0AJ271208.1 Zea mays mRNA for putative MADS-domain transcription factor (m17 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951767.11e-172PREDICTED: MADS-box protein ZMM17
SwissprotQ8VWM81e-166M17_MAIZE; MADS-box protein ZMM17
TrEMBLK3YV871e-172K3YV87_SETIT; Uncharacterized protein
STRINGSi018183m1e-172(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.29e-46MIKC_MADS family protein